PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000247249
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 334aa    MW: 36745.9 Da    PI: 6.6396
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000247249genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP52.42.2e-165694341
            TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGf 41
                   g kdrhsk+ T++ +RdRRv ls+++a++f+dLqd+LG+
  MDP0000247249 56 GIKDRHSKVWTSKRLRDRRVHLSVTTAIQFYDLQDRLGL 94
                   679***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136912.06657115IPR017887Transcription factor TCP subgroup
PfamPF036348.9E-155794IPR005333Transcription factor, TCP
HamapMF_00032134.23779334IPR002769Translation initiation factor IF6
SMARTSM006543.9E-13592293IPR002769Translation initiation factor IF6
SuperFamilySSF559095.2E-9294313No hitNo description
Gene3DG3DSA:3.75.10.102.0E-11594313No hitNo description
PfamPF019125.4E-8194292IPR002769Translation initiation factor IF6
CDDcd005272.36E-12694312IPR002769Translation initiation factor IF6
TIGRFAMsTIGR003231.9E-8195313IPR002769Translation initiation factor IF6
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0042256Biological Processmature ribosome assembly
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0043022Molecular Functionribosome binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MAAVEIINHH PKTKIIKTHH AQTSRRSPPP PPQLMRETVS MGCTTPRIIC VSRASGIKDR  60
HSKVWTSKRL RDRRVHLSVT TAIQFYDLQD RLGLQFENSC EVGVFSKLTN AYCLVSIGGS  120
ENFYSTFEAE LADVIPVVKT SIGGTRIIGR LCAGNKNGLL LPHTTTDQEL QHLRNSLPDN  180
VVVQRIEERL SALGNCIACN DHVALTHTDL DRETEEMIAD VLGVEVFRQT IAGNILVGSY  240
CSFTNRGGLV HPHTSVEDLD ELSTLLQVPL VAGTVNRGSE VIAAGMTVND WTAFCGLDTT  300
ATELSVIESV FKLREAQPSA IVDEMRKSLI DSYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3j2i_B1e-132953336244Eukaryotic translation initiation factor 6
3jct_y1e-132953336244Eukaryotic translation initiation factor 6
4v7f_m1e-132953336244Eukaryotic translation initiation factor 6
5fl8_m1e-132953336244Eukaryotic translation initiation factor 6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.34930.0bud| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339142.11e-177PREDICTED: eukaryotic translation initiation factor 6-2
RefseqXP_009348136.11e-177PREDICTED: eukaryotic translation initiation factor 6-2
SwissprotQ9M0601e-165IF62_ARATH; Eukaryotic translation initiation factor 6-2
TrEMBLM5VL361e-174M5VL36_PRUPE; Eukaryotic translation initiation factor 6
STRINGGLYMA09G28640.11e-169(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30210.22e-18TCP family protein